@p,p ppp@x@tSSSS$S,0ST0SX0@S(0S`0Sh0@S0S0S0@S0S0S|0@Sx0Sp0St0S0S0S 0Sd0@S0@c|A67c71c5386cKHNEc@cc CRcccc,&c0C!c'00c$c2c3c1c c@c Xc@cX"'c qqq@qqq`qxV4qq|(q0q)lO0P 8 80 C P\@ @ @hh Pq   MBMOР iHM!&BB/B H4P #ML@B@OЍHMt!&BB/B H4P #MBMOР iHM!&BB/B H4P #MBMOР iHM4"&BB/B H4P #dMBMOР iHM"&BB/B H4P #MBMOР iHM"&BB/B H4P #$MBMOР iHMT#&BB/B H4P #^-pPp`W 004; 0Q@ /0  H@A_o@pvVYpW S@ start.Sq$///////?///.3///0///1///3//2/2//0///10J//3/////6///=Yj=Yj=Yj=Yj=Yf=Yj=Yf0/0L01///00000000/2/0//00/110/////0//0/02`.3vqtqqtqstart.S/home/hico/subversion/uboot/mx53/u-boot-2010.06/arch/arm/cpu/arm_cortexa8GNU AS 2.24.0%=qqtAaeabi 5p/R/ 2s//0/(q0/(q00`/(q///@-0?)10!"0)Sp0!"0)S<!"0) S=!"0) S<!"0) S!"0) S!"0) S<!"0* S<!"0) S0C!")H 0S<0< .?8? ?;0?@ppp "0 "0 / 0//OS/@-hh0? S S 0CShhh00Sp#qx#q#q#q#q#q#q#q#qxtp l hd`\XTah0q0qS1q1q1q 1q;q1q(qB1q#1q-1q31q91q>1qG1qK1q'1qP1q@-1`?o20IP  ` 0P 8hЍY1q 0P/,//,,//S@-!?0?1 * !S "7t9l9`9X9L9D98z909$t99n9}9h9w9b9q9\9k9V9e9P9_9J9Y9D9|S9p>9hM9\89TG9@ccc8)4)(b),r)0)'ܑ'+ +!+"+#+$+%+&+'@-9+9(92/2 ""R"('qt'q<'qL'q\'q\'qd'qd'ql'ql'ql'ql'ql'ql'ql'ql'qQ  Q   Q     !  0! 8y88R8y8/8858t8ly8`8Xy8L8Dy8880y8$8y88y88y88y88y8p8998=8q8|{8>8hq8\00) c$"dS(q0 p*pt*H)l*X2*\B*db*hr*`R*L*P*T"*0-$-OS@-(MS뛃P <f8如@P .P f@@x9r9o9卂1. 0S  000 u}@T T 8Q68l8dy$8 X@H 8?@ 0?8?0?(Ѝ1q1q1q1q8q1q+ň+OS8@-H@H ?R0@T ?B/P /PU 0_C8 NS@-$@DP TSB-p`PA1/S  @T( /C}/ 0@/C ?R 0@T ?Bo/?R  @P @t0?SPU:6P/S  OCOC(@/CN/@TY NSp@-`5@PH 0شP@T 0H$HOC/C/C /Cp0qSp@-0`<@P?DoD/0?DPoD /pS@-@PpP P,0`?FhPP?VT00?F>V@T :T `0/C@P T D0/C>S04@,0/S  @T /C.S Np@-@H`PPP `3PT 000@/C$0?S  @T .pS N80  $08 < 4 0008 <";00/p@-`0@5)"(DP0@0 50@00pPU .pq 8@-@28)1$0 1P08P01S $0 R`aTA@ HL$H>T @@ H?$H bF:@-T@@T L0/R  /0  ?1?0?(c ?1?01c ?1?01cB-0Q@0`S 00qr H$HA  !88"81 Sh0!qp 0 P$  P$v'tFdN-Pᜰ 10@ Ƞ#Ȍ`p Td 0R R0 R RPt `nST 0 00  0e! `1 pp011@/ [:?T1? MT 0 0b0 1!p !  !$3 V 0 ` p[:$VTd0 p4d `L V: U *T$ 1:61PЍc@- !0 R/ `Q Q Q 0Q PQ Q pQ Q Q Q  T0!H 1< !$!@@@N-`p PVAPp`0 V V *pV00% V#W  pZ  t 0E010S @1@!p !/!/ !m! PV V( V0S 0q010S 0!p !/!/ !I0SU \x 0N@0@!p !/!/ !-p+Nacs@-0a0S* 0S @0T P 1:61?1? 01  @P P1p001?1? 01(0S Ѝpc8@-@ d^PPpp  :% [^PP *1%R^P,,\ 8 $%000P08P00/)/! !/( // / Q4      @ H  , / /8q qq5q, qcNqLGqPq@q@q?q|>qAqlGq?qp?q$?qt>ql>qT>qH q0S0S0S/0/0   0#20S00S#S00S x0P̃ PT RH3i> 00 0$ i> qXq qqq0  . q0  .@ Xq0  0 0TS$ 0P΃ qHq q0  @ R0%SR$ 0P̃ xqqXq0  `0i>@R0SR 0RHS  0P΃ VHq qq0   00΀S Fq qB-@P0!Q  Q 00Sđ S㸑pWV0 &?1`|QtWV `0&:6`HQ DQ @qy[8v[0 s[ $o[l[+"+ ?g[d[a[^[[[X[U[QP[M[2SG[D[2S>[;[,Q Bt5[pB2[qDqUqqYq]q[qaqqqqѶqqq!q;qVqqqqq·q߷qqq2qOqgqN-,a@T2 P0S+0p00 P4 P50S p00P ZZ Z4Z .Z||| Z`L0P !R R0T0S ЍN/Ѝ< qqqָqlvqqqH @-@$ @0a0/4 @ , + /4 @ , + / "0qF-02  Š @)   &(, t+'$|"$p 0@.. l@-h@-d@,`@,\@+X@*T@)P@(L@(H@'D@%@@%<@$8@!4@ x@E@P圠`}ᄞqON`M`L`J`G%cP@^]@[@Z@CP@UWᴠ PḠR  àČ #$ #$ #$$p #$(` #$,@0340P0q8@-P@fU% 0 R !|  Bt $  Bx    D   B   PP C  8@ 0qP@-t@8  @    @  @-A       x@ @    @    @ 0 $  B\`/qN-p0@ ,P0<` PtB] t PGE0@ 2J= @ P(0GPPT  P GE(0@ 0J0tEV  PtGF_  PGE@ tJf  PGEt@f BP ` Pt~Jp @ PGE@ JEVE x PGE@ JEVE_h k PGE@ JEV~PZ ] P(0GJ0 T PGE@(0 J02 XF PGtJ| 8= P BtኵpGX. 1 PGE@ tJ~q $ P tEF  PtB@P  Pt`P@  PP@GX^0>681@PЍ趿qqqſq˿qѿq׿qܿqqqqqqqq qqqqq@-`0p@PPcP P wP lP `|xPl U\TP@ J0,P  ?P 4P )yPbptP LiPp `$^PH 8SP mHP =P W2P ih'Pt dA@PL <64Pb P CP P -`P 8Pl \P@ z0P oP dP YPb0P I| P` >PP8 3(P  (xP tmP LbP (WPd TqLP< ,f$AP<P sl1P KD&P ] P t5P\ LGP0 P 1P `P  @|q q#q&q -q1q9q=qFqOqq$(,04q@DHLPLqdhlpt4q@-@PpM0`@@P P@p 0  C`F > : 6 2<`F - ) >% Ѝ@HqLqOq@-3@@-@  t dp T D 0T  !      ,  ,h p |H,lPh d @L T?<X?RM<DHLPN-80@0D00H00L004`((- 7 3 / + ' # d   8 lx ЍN Ѝ 0H48L<@P D$HT(LN-<00@0(,p0`4P8@0 P@-./////////@-N1qp@-A0C H  H 0 000`00b 0PU 5/P @&O^N-!qS@2jcSNunl)jP  T0P jP D T g8?N]DqHqq(q2q!2q(2qXq12q|Mq:2q@- 00100qATN-@` pi@`P`iP  phN] 0PAP0@ 0  ,10 0U0 0000!   P P 00 W0 10dQ h R 0p a0 100@H@@M룘 :/Ѝqqq0qATAT ATBT$q/0M00cS00Ѝ/8@-_@8-004; 0Q@0  @A_opv^YpW S@P_ T0?8T80?8@-OJO  /@-O@O ///@- @2B2q0@-@M 00<0,08 040@PNq:qMqWq:q:q ;qSN-00CR  DQQ000CS0S0S  @ <2  pQ RZ` /2 RP0 R 5R0S  0 P2 R98P  0S  2 l@JP  0S E0 0oK:g0P 0nS 1 Z P T RRP RL  ,1 R<<<@P,!+$k`0P00`㼙 <  4 ` 8  s 0Bp@`@d@C D0PJЍWqcSc(q)q )q)q|Mq12q7;q9q(q 9q(qL`qq(qZ;qN-Pa帑 M PJ@!@+ 0@0P 0] ,  P!( G  P!, B P!0 = P!4 8 0  82   0B0 8< 0 40s0찋  C D0P PP0pPe P< 0{ ЍWq(qo;qq(q|Mq`q̕q@-,00cS fJ@d@uWq7qL`qps@-@`APT  T @0S@VЍp@-@f  00 0 00 0@-@M CЍ4q@-@,0 MP    Ѝ4q4q/0/(qH0p@-`P@TpP 4@0Tp(q80 R 0Q 40S//(q<0P 0P 40P///(q8@-t@P R0XePD^C oP4Q04P0408(q4qB-0@$RM@00Y\P @TI?Y`qneAY`IY  9P@I _  /P ph (P   "P @wI8tI0 qI  00S 1V .eP   00 0 00 04@0`Ttp =IQ ePtPB I003/Ѝ(q6q4q9q4q$q4q5q55q4q4q4q4q@- @P,03/ 0 (q$0 P $0 //(q0P (0//(q8@-PdP@0S8tP8U040X0dP@uB,0P 0R 0 8U5q(q_5q4q(q@-@0SpP`H P   :4P0`UL0` 03/P0P 0 0V Ѝ(q6qp@-@0Sp)B 0PS 0S `adP 0SD0`8p@B040V0 %PPp(q4q0 0P/(q 1q 0 /(q/ @-  0 Q   Ѝ(q@-9 0 (q@-!d@8@-d@PP P P& P  0@00] 0S 0 S0 \00T00L0 080080S: 0 8b5q(qk5q_5qo5qxq'q0 /(q8@-$@P8PP8(q0Q A0#8 8#8 /@-00o00 "448 s0#8:# R/q@-0` p"448sP@ #HAd =:#2#Q("<"$ #<40"<"$!q(qs@-P,` < @0 ` 0 $`000!  04 0000000080#@  <0SDqG40@0@00! ,`[Ѝp(qqt5q@-X@40S5D00cSH00cSH0 MG0H0@D@(q5q@-8Q L@R\`0+40X@lE0@0`;`0`0p 8` #,#48#80@000 00 p` &0& 106"448#8aa1\0 @c@h@HpDV(qN-u Qlp]|%|EP,4 ă%$$ Ƞ,Ƞ\5P(\"( R%DTX4E%X UQ@%ĠTX%XA U@AQ5 ʠ, S2 Q,4 4%ĠT:X#:%X@Aʠ,ʠ\ S:#: S4`U |4Ue  UQbڰ "448S  "448SZ R00S   00 R "448#8S S  <pP0 @ $ 0408SS X0S  @0 R XX \\h9040h0X0Q 5 "448S "448S  "448S 2R x,tt0S` P  0aQ}P%4TX%XQ Fr0 @Rn0Sk PEc  t00 SR00  T "449O 0S7Q- Q#p Xp < R ppd a Epq#Q! 0 p P DD"D049DpP  D20tS 0c0P0p3/0S S S 1 Q  PC1H$  8}=41( x$ u=+)000Y 񟗺q$qȴqĴqq8qȴqdq 000f 000 00000000 0h7 Ѝ(qHq!2q?6qI6qQ6qZ6qq[6q`6q6q6q(q+q6q6q6q7q$7qG7qK7qXqT7qWq4WqУq'q<, <4 /p@-M`  xP0P0S 0S@T H0V 0V ۍpNq0@-M  d0 P R R  R @T   ۍNq0@-M  T0 P R  R @T @ ۍNq0@-M  \0 P R R  R@T0  ۍNq0B-M r ]P0P(0S% 0S"0S@TK{7w`/SP \^ P P N P0` @ G P0@ۍNqMq@-@ @0S: 0@/RF-AM " v 4`@P0 p  U`Fa   0T@0DA10 000Aߍ+[qF-@`M MPt0 0p pUQ  `0Pp}  @0Vo  0V  PTX0ۍ ЍNq(q)qB-M ` P@ pP V00 C1!   U00000g C1ڍ襆B-M 0 r# 0S ` ^P@w pP V00 C1!  { U00000g C1oڍNqB-M ` 5 Pa L$@ pP V00 C1!  O U00000g C1CڍNq@-MMp ` T @5  0 P(0,00e$ C1$ڍЍNq0@-MM @ P,  00e C1ڍЍ0Nqp@-`Md  00P50S1 0S0S0S S%`"PP QxXAxQ#EA`@0H Pd 00 RP5ۍpNq qu9qXqxMq-0DM\  BR0xqqqqqqq0 0 00 0$ 0 $000 0 $0 ` 0P P`( dEcDЍNq qp@-|AX Qp \00CSTqqqqqhq$q8\0F,X.~P0= P p@@@h 0 pP 0\00;d0$`P @PPP`PP`@0&Pt}U\ 0PP0S0U0h00\0p@^pNq]7qv7q7q(q7q q7qq@-< l00Sl0(@@7|@}|@@Nq7q7qq0@-AQh00aT0p0P00S1! !4!0| PlP_@ :pPP TPPP``00@P``C@ ?@0S 0P 0 0R /@PP` *@Q $@ 0@}| 0\0? dlX0h Ѝ@Nq)q|Mq(q7q8qG8qNqX8q(q(q8qMq8q8q+[qXq8qq<q)q@-D[0P 0nS (0  P@c@9q(q 9qB-0`?P <00@0P<p0 P< d8 400`000,,B$4Wq(q9qq5(q(qqpq@-,00cS ?@D@4Wq7qq@-d1dQp00C`SGPqqq8qq<@0 ?@q@  , @0  f;008#,#48#80<0<0l <0<0L0 Ѝ(q8WqF 㞍Q#>h喍Q\> <1 R  匐Q  >=0 `S00@0 0 B0# pG `0 R`50W(>  "4$("(x> "448#80CSTx>a H0 @q>B(8Wq[9q$qc9qu9qy9qqXqxMq7q9q9q(q9q@-D D@000 S,U>@ Q>Q@8Wq$q7q7qq@-dZP\R  HZP  Q* <>/ 2 b2p B0W01! !4!0  p>:pP pe 00LaLqP>H =@0S 41P 0 0R = a==Q =  =0== 00E0`000`㈌ |`<0 Ѝ@(9q$q9q9q|Mq)q8Wq(q8q8qG8q1:q(q(q8qMq# e0a! 00 00 5 a0 0 0 3b010 Š\0n000000pQp@-PP@`b0`F0P 00Ĵ0 DeQӴP@0 c R  p;qN-` 0$![Z Ѝ @P0   Ԅ ))"p )6 ✐ ੕ a! 0 `0  #1 Š`0n00000`FꟆN-XMxp ZP' p|@ R r0@D-@D+ @D[ Z@D@D 00`0 Q JZ `X ` PE@ 0```f0V0c  R STZ/@PbYP[ 0 Z  PX  P 0   RTZ/@Pb0CV0  0 E0SRWUZVP0 0S STZPXЍ8q0@-0@0S 0x\ D0 R R  P0DQ 000C 0C070CS*0 P08q@--\ @`@-@0 KR GR MR kR  iR BR000B-00S 0xQD0 #R  R 0@PD\0@D @D@7@Dp_UT`*bq'8qN-`PPM0Sv %S@070+S  S #S @@-S 0S@@@@0C Q0p`0@ Q '0pG*Sp0p W`pg@0.S00C Q  00A S 0)0I0*SY0  0hStSL\Z\Q`0 lS`lQL0`nQ cQ %Q XQ dQ iQ sQ oQ pQ uQ xQ @ pGW 000 P EpGW  @ 00 0R@Hr 0MS IS oiS mSk@@(0ß $ QP:00Q$@@06S#(0, , $ QP:00Q !4S@@&0($ 0 % l0JQA$S.0S00@@@( 0C w0p @!@ @0P0`8 0  ?0 k 9P6 @%000S0PP`F) LS    lS  ZP tS hS0S("(B(S0? @fP `k0PЍ;q8q8q-@-   sЍ Ѝ/-@-p3 E3$ 0 ЍЍ/᠆N-0U`p 303:́ 0@TPVWV# 2\ `pUT:@TP 0`pf` Ѝ/ 0 /S0? /OS6nN-@8M Q :<0QT 2T 傁<0P} 2  21 0( ,01P0  000 40 0X040 0u0p0 WVWV [Z 0P*5%00 400"!0 40 0N00 ! R0 0,(<,0 0 004040-00 $(0@ ST 0@0d@ 00` $  0, 000(ހ(,((0 08Ѝ6n$@B;q\q@-  "2P3 0  ཀ?w@-d0/?G5I#;0@8#8S S S$$កOSc@cc@-d0/?K8E#80@6#:S S S$$~OSc@cc0? OS0? OS@-h0/?~G4I<0@00#2S :S($ OOScc@c@-d ?@4#<S :S@<8k?800/OScc@c@0/ ?:#6 SL/OScc@c8@-(0O[L%$D@8OSH0/ @-O80!10OS@-0O!OS@-0OOS@-0O!OS@-,0?E$K@ OS@-0OOS00?;#5S S S OSp@-P`U P@@40P00@/@D*FOPppOS@-0OOScP qqqqqqqqqqqqqqqqq@Ubt}/@-0,V$0 O0 |H0/09000V0>0D0T0i00x0^l0`0K@P0c@B;q@c <qc<q/<qE<q[<qq<q<q<q<q<q<q<q =q!=q7=qM=q@- P6qqqqqq$q4qDqTq[Y0%tch\P<06H~@60a420c=qt=q=q=q=q=q=q=q=q@B >q>qN-EMRhqqx qx qx qx qx q qh q j  @P h0#X%Xş0?L5 AA  A$A Q @T/ 3?S   @P?:#6 S h0?h4   B "     B   B "  $   B ! 0?3   B "     B   B "  $   B R  R \3_2`T <~dQ}}P#U@[ `*~dQ}}`~dQ}p}p~dQ}`}`L2`"/X"/ ,2Q  0!@P0 )/: / 1   B"     B   B"  $   B R Y#Wp#V`#WIYXpGx81`F{eoOT (.6 q0T_oi.@9%UPUpP U P UPP}QP}N}P0e@H0P00D.Ѝ@B7>qOS2cV>qcUTQE@clvqt>q>q8@-Z@XP(}@$BP0 .8@B>q;#;3, 9CSQ //DS/ 0 /HS 0  /HS0/0S0 $02000/SXq <0 94 0d00S 00<00XqS@-00SXq80$40P 5 a ~#B2% 0  a0/SXq@-@d0/Xq@-D0@0S|$ P$00aS$05:XqS@-  "2P3 0  |?w@-@x}|p-\v|X-@o|@-0- -8q@B;q <q<q/<qE<q@-0 @P|8q0 0 0 /8q6n8@-h 08@00T#2~G\IS@P :S)|88q@-h@ 004#<S :S~ 0$0800 |8q@- @ 0 HqXqp@-h00SX@P`0S  0 0S 0h 0 0b 0U@PpXqHqP8@-P8<0@0S(0T"@@ 8@VXqHq8@-1@00HPP 0 00 0 uP P 0S,0 0(0 r  8@ Xq|qhqlvq00/00/00/00/0-aPӴ0aPеô/0-aP^ 0- AS0̱0 AS0ܱ/0- AS ^0 L-@PT { `ppVp ` {0003/P04 P 00\1 R 0S @\  Bi 0 V` p N-p(M\  @_i 0P(6$[00 ;0m 0`P #0\T 0S"0 PPQ `0 .  ` T 2i0  0 0 8 Z 0  T i0 z 0 0    )Z  #0q a 0d0 00000000 0CS 00    V!- r !r+ 0 00r0 00   Q   %0b<S0 0  r 9  0"0 V0 0  0$$\  0 0  00 0P000 0  00 0P 000000000w`` Z  "(ЍCq DqDDq]Dq0P  (Q|P $ l( !RL !$  !Q<  Q! ! $ \ !qdqqq@-@\ Lh11SPo0@-P@00@?0.P%P P @$@000@,1 ,1 01,ƒ00@00 0A@0@0q0@-@@$,00#0 "UUP(.UUP$#TTP  P@,P@,@ @  #""  >? 3"0084 0\ 0SI0@-< (@R$  o?0[?fWS0K/ /S0K/@ P  /S0K /S@-@@P  8@-T0/{/{/D@ <0Pw?9s?+0c?__K_0{?0?8S'@ 0K?@ /S@-@    x  dt Thdf3PP  H@<ЍGqGqGqGqGq HqHq4qGqHq%Hq9Hq0/Rp@-Pc@ @D`TbP SP bGRE @@pqHqHq<, <4 /p@-Mm30$ PP U@P S@e`@ V<@aD   ,  ܍pq_Iq^Iq@-=3 hIq @-`@$c&4//pIqN-?p"0PS 0  $0S Y`@ @ T``@P [@ [ 00@D2P<```@4&  04/Ѝq+[qIqdcN-p0,`(@4P80$V V $T  8$0000 IXP000 tY D&\ Y :& T#*0SЍIqJqqJq-Jq~Jq8@-@!%PPt0Pp#P\o$L#P< 8P,P8JqJqV'JqJqKq!Kqq2KqR@-H0@p@`P PP`UXqN-hCp L#PU4aPPpG e !W2P P%$PTP`$PS;2儰%2P &%V#Pd%#[ @Z#P,y |%Qow%0S S S !0T# @0P0 TW@ 0PD0U%kO% `T0,S` F$PP0 0 0]00\0^ @0LD0XSP( 0`0C00[[  d00h00  0$P  0H`0Ph%`ЍYqLKqIKqXqSKqV'JqJqKq$Kqq8ZqKqYqKqKqKq Lq0LqULq/B- Mp `P PU G RPA0SDh H00^ $1U U: U;X0H0\00]000 000;@P*@U U U&0 9/@P 0 9/@Pt 0 9/@P P' 09/@ Ѝ\qYqtLqqLqLqLqN-P0@MR`0   0 :RR00#R00S  0rp  zpP}BX00\0H0]000 000Pp pD0S "0Sp3$  0p[ f=]0S$[ ^40P (TPT : 7 p7FP 7P >1*5`0F3/&#0^0S^ 0qW [ -^6"^ t# V_ 007/#  0p@ЍYqLq7Mq~Mq_5qG7qK7qqMq@-,@P SqqR@- RP P$0P  <耧q-Qq1QqR@- RP P P P$0P  耧q-QqJQq@-O)`@T 4 4pDI.O0.0R \S0.0PH01S<0<PU @ ЍQqRqqquq 0 B0 S 000C P 2#0//-X P0S DЍ(q?6q(qI6q>NqLnqMqUnq(q!2q)qQ6qNq^nq^NqdnqF-pM`@P"P  wh1T T T O! g@Z 1   V0 P9-@PP3'Q/lTQ p"P x[@P0d0 @R 0@PRT @Ѝ(2qXq|Mq~Mqk5qknqR "@-@-0y+$qpq0/,q@-40Q0  0S "Ѝpq@-P@p: W`0@=S0S * =PN-Mp@ "PP -=) 2PT.  P( TP@@` 0`[F `T`Y PTV  #P ЍB-R@M`@P;:"@ PP$ Pp =P ?UP0 ?0``V@ @0P @`E!P  P@TP  q|P ,@PU@Ѝ%pqCpqdpqN-0@0 PP `=aP Pp#0000S 0 0Re0*P0p<$P ,P P [)P 0SWpG0Ǖ P K P P P 2P 0 pR  R00Z @P[0S 0p 0R RWp  []VAYPP=?qStqVtqYtq\tq`tq_tqqbtqdtqhtqltqptqttqxtq@- qpq@- ^P@@ T @@@o ^@<Zq+[qF-@.pQPPi WP0`G'T  1PHU `@V 0 0aC1q4$qm۶@-@D b8_P$NK =tqtq uqN-MpZP@`G1 00 `M 0 Sr"!0EZ@%p @0 0(0 $ P $ (0 p SW Jp5P W | 0@TР iP @` V@K*uq4uq@-8zP000,uP00pP003rqdqpq.qqN-0M00`` 0s@P 0P00(@S64P  P P P t0!0P  RR U0  01U $ 3 @SN T0x3@l0H $ U00 T0S tP \0$07$00 t00@p' 0 0 00j00R0 Y 00  0 I000Y 0   08 SP 80< S@ <00000fS 0` `0Ѝdq0qT@-P0p `PQ$ @pbo0r0SpW` F$R@R0 R0$R 00   50qN-@Q&TЍNH YP UpDd0 S   S `\ i 00 \ 0 P 0 0`S`fm S:0 Sgp   E$RR R @ $R   @  @00 i   00 [- 0 0 0 0  E$RR0R00 0@ 0$R0 000@00 0@000000 P' Z* 0 0  E$RR0R00 0@ 0$R0 000@00 0@000000 Pp7rs`P! 0 F00R00P(  E$RR0 0R00 00 0$R0 0  00000   @ iR0 0 0 0000000 000Ѝ0qB-pQWB PWpUPPP SJQ@I `G0g```F0dS0`@d00d  0   00@@ f@000eS00PPW  KP/0 @/@/PdqXqLq@q<0  404$0Q0@//0qdq@-0@ C</q0 R00/Dq 0S  0/Dq0 R00/Dq@-0@*\+ w  /qDq@- q 80R@(;S N 000/quqN-@@Pp P; `P` =Pj [ 0 CTY000 01 @ Y  SP00 1   00 @ 0000pi0pG01Ѝ3[q//@-p@0(!( 0 ! 0! 0! 0! 0!  00 0  $ ( , 0 4 8 < @0 D H L P T X0 \0 `0 d0 h0 l0q@qqqqqHqqqq qqHq|4qqDqqq.q-q0 0R00/0 P/0/0/uqN-@`T. `p0WP0S0  S 000000P `p0P00@Ѝ@-UPuq@-Puqp@-0PS  R0S 000`@ 00   0 pF-@Pp`^PC Y e p@  ` K0ZP0) RPp0p$S,p0?S(  P pW pW 0`@ 0p0W @  P 00TeqqN-R0p,@ T. 5RP $%@@`Vx0,PU 0PP003PPz(  @`Ѝeq0quqdpqP/H 000 0   _S R=Co//8qN-0@S_*PO00 p0xqxa0000 P PP0P[0Q40 S8` 00 S4/`P'0 S 8pvs  P*n 0P70 098000S 908 00P0S 00 R  uqqeqp@-`0@S Pd00eP[0S `0 00pR8@-@P8@ P \P 8vq p@-P<0<@M( G`0F FPP@peqPmq0!0 N-p@P h$=ܿP@1@@,PU ᵿP P/`P P ,P P@T`  ᓿP 0S @Y@T Y0S00 Ἷ@@8q vqeqPvqP/0p@-P`,@T _P @p 0,`S p@80S`00p@eqPvq@-    8@-@P0 P0 P 0P8B-`@@qPE0   P UUPPW ]PP PPP 0S 0 S29 0 0!0 000  0 '0 pW:pqqB-0pS0S0PS` 0S 0 P @o0SP  R \R00P@0@A0P 0@000S @@ 0SA R \R0  @ R 00N/eq@-LH@PD0P ,8P90(P @fvqeqjvqRmqnvqsvqB-@PM. 0S+ P ^P㤐p 0S ``x00 0p`@u 0p0 0@ЍqqlvqN-0P(MS  0 B Bo/o" SH L70 Q  R RR  R p`000 00000U1 00CS VoP0S0P 0 @ TppW p @pWp0D 000 D/oS" R0|?oTQ2y TppW T0S 0S`00Yb 0000忽 0I00P0> A0S0 S 㝽0Pi ᣽0pq$0 0 0pG;0F0  M0 0 $0 0 0R 0 00 0 00000Y0 0 0 @ pP }0 0 000 T T0S T0S000 00 00S #S4`P [ qXPY. W+0P :=` P0090` 00V -p`p0 1W 00C 0 q 0 0P 0 R. p`C[ iټ :W`p 剼 ᆼ˼0[ p0 F1(`,;㧼P0 opP0h $ X1R 0 iRe0 00 00wqQ/@-@^@ wqlvq0SS/ / wqq  xqHq xq,q -xqq@- @zq,q 5xqq@-//F-@(,pP@`@P$Pj D0S "0S  q 0000@T0@@@@M ٻPP@:R oP`= oP5 - V *rP$ 0S0 S0S \ P @@001 ЍyqyqyqJqJqKq$KqqVyqqyqB-p0Q@ S`AP0 Sڐ00C00P S h00000U0: U 00C000C0qq@-QPp` @P" BT@@Q@ @aT DE0`p  000@T 0 p  000N|q/p@-X@PPX PP  2PO 00U0S`, xVP@ Ie@ 囹@T IP =@Ppb0$U00S e@PE >T000?S|qhIq]|q|q'|qF-0$M0p@ h0S(00 0(`0S00W 00 0PPPY ;0@ 0>U3 P [P lP) Pd7 RP P P 0 P00!SS_ 01X0 0S0\wS00 00 0MU [PP ;0@  0A0@SDqx qDqhqTqTqTqq 0PEPZ:; 0@ 0P: P/ #PP [:P P PPP PW Pp Pn PU n00C0P$0 S*b00PUz Z00C Pq*JZ   p  ^ DBZJQ 0ZX* 0Z* 5 ZJ'- RF*b < 00?Z 00C0 0S3 0Z*  ZJ #Q A a ষ $  ZJ 00CmBq0Q33 1#0SS 00S000S 1Z`PU 00C0 0S 0U* P UPE 2ᆶ R *b 000 S*  o 0 00"0P 0 c 00 0;@0  0 2 {P0 IpPO` V V V4 V <V  V 6V V' 10x0SdT00P0 S<H00C0000S  0@P0S0 S0S  0/P 0R! V00 0HPPP0x00000000`0P00$Ѝ\nqqN|q+[q|qqq004q@-@A0 R R R @0  RR!0 T0 |qN-MP᜵0k VP S@p@V \Do\RQ W@V`E00]S@ S# p\ S S \0R0'T  R>$T00S0?3p(T{T003 $ V @P``FP/p)T}T'0 j BSڷͷ0+0 (CH P@ 0S V0`F0'Do\RQ@`FP0 00'@ ۍF-@BM M`T 0S  P:l:UP@⳴0SI 0@0pQ 'QS\\ ";AoP"  S\R p"F"  P# P0Zڣ |0\` h  0 P 840 d   Ѝ0}q}q}q7@- 0P@$Pd 0   0P 8x40 ,   Ѝ0}q}q}q/00@  R/a0@SW@/A0@S7@/8@-@PPP88N-pP0S SS[ P00K@` Svqqqq@qq@qqqq@@@@  @@ @ 0 S H 3! RA > P@@`P0@40@`P@ P@ @@` 0eSrP@@`iP@@P  #/qP p@-`D04P@0Up4@EPPpP/qqP/8@-<P@P <  8@-P$048 840408 q-p0DM4 4 8 `a< ϲH 1080$000(0,000(0,0DЍq~qdq`dqcqDdqN-`@0P R Q Pt    @   0  Q%Q   R@Q *Q@ " "Q  R0 " "P  R @ B"0 B @ZTLT@@hQ@T@ @ QhQ@H lQL@P Y iP@W XPQ %PT cP dPsP$ nP= oP uP xP8 >r @a \P0_\r!p0  P P G S 0 f:  %YK000  -S Y0S< R0D R R..7S00 *R0% ZQp HQ LQ*lQ zQ hQ ˳Ƴ0SPЍ8q-@-   Ѝ Ѝ/<, <4 /0@-@AMLP ᯵ P 0S  0塵Aߍ0$~q-~q3~q 0 R0S  (qnq=~qE~qp@-PH0@P @`@ *@fOoBpV'N-@P@ p` zPZ0㓴$ 0S@TP@(0S PU0 W@V00ЍqM~q@-@MR` @P-pP 0P@# (00CS %@P dQ CP VP 2S 7OoB@Ѝe~q~q8@-@PPPU $88~q@-'P@ ӲP/ @-P0M  徯 4@ l$ ᵯ Pۍ(q0qqQ: @-/~qp@-`P0@AǯPpPUp@q@- P0U?T@p`@ 0 PPPP @00C?o200SPqN-@!M`p 04;00kOP 0SPP P FY'PlUPxhNU`H0Si&q&qx'q&q'q4 0:$tQp0 0)PQ Ea>0 pP .P6. P,|tPZ P P  >OP 0  y P 00u E峯#P  0ݳZ0SPP2 Y :Y, PUNJ ⭯ @ ⥯)P (1@ 0@ E<(P0 RY ($ <2S0@@D 㭮P  r0 10h'U( w!ލ+[qK7q(oq9qLq.q;qHqWqdqtq~qqqqqqqLKqq qRq/qXqlvqh(qqTqN-@pM \P@@X@ WXA 8 @ W@ڈ2H@@Wt wP~ \2 0c?o20 0Pu ,6P` 0P` *P``WV 0S VO0@S  RS0 V/ 0vPB 0XS00S00P< 8V V VX+ײ"1P P P X0ò@X 0⼲@(XP  @L08S l  0PT @ߍ(qPqoq`qq(2q+[qfqqlq{qqqqN-PRM L@ $HIU'P匭PD00 0P   @#`P7Us pP 0S UH 8b0PS  0  0$H 0Pi 0(0S``&P` e $ ?QP*4]U O PP b PL p6 @PG $ 4(0@aS080S- T+|$ ҭ$0 p0 $0ʭz0 00000 0 @D0$4@0$8$L0@ w& 4 0 8 0 LP $ 㤭$0@$@ P 2S  `a $ 0 P 0( R $ O P :8ZP (@{p r0$S0401(D0 0 0 [Z* 01/P @P 01/PT0 0( R80Sl 2SX P Rߍ荦qˁq q@qCqSqqqqqhqӂqqqB-`00MR@0.<P( P$ !@P qNPp0 @P 0P@# P #Pl $@ P@ &P0 ,}$z0ЍqCqBqaqqqqH-@`p4PP P * `M ͫ *РKq8@-P4@40T*P @88d$qT(q@-@PЍ@-M@PdPP P] 0SX3/U P @@1<P嶫(0P0C(QP S<D5q$6q6q6q6q6qt5q6q6qX5q 匰20 * p8]0` y80S S` '%nX^P @hWd0T$Q 0(0XЍ1qoqqqq^qq3~q-~qqq ql:qp@-@ M0T *P`{0 @@ @ P``P P0T* L(c P 0S (@XP Ѝpd$qT(q&q$~q/qB-P@p*`P 0S D3/ @000T TP   V@ 0S 3/TЍ,q7q@-z@ ׯ1 qiq@-@{^q7@-4@ Q PP P P Ѝ01 q; q<, <4 /@-@`@  0P`P` a P  PV(Ѝpx(qp8qNq@-o0/D q 0 /D q0@-PMP P@P% = P H#P% 0S 0 0S 0- xIP@dCP X@$#Q 0 0S 0- Ѝ0,qq݈qq#q5qq@-40#P@@ 0  #eqq^qRqqp@-P`llt@"0S 0S @j03/Pp, 0S 0C0p@pqqlvqD q3qtqN-@XM p@@=P P P ``UB (0@S S PX`@PQ I0S0-01@@[  P "P 0S X0㕣#t*0SX0%00\0WpT0 p⟮@P(PXЍoqqqq+[qqq qцq Lq qֆq @-,0 xP VoD qqq/+[q@- @0 ]1qH qq0@-@-0qH q @-@0-$u$qH q0@-@Md0@ -HPP P0T *X0S#0S, ) @ Ѝ0H qqu(qN-D@MT P0Cl,#l8d*p#dPթ30 00P0LPSL0CTS.P'0q70`PT0LD0 Q8̩4륨(pP L,㽨Q0S 0 @PpS2"Pp! P\Q=P\  "T \@ P0<岨P0 "000妨P 塨P 1` 喨P P a |1 儨P P H!H1 pwP [ ;!1 @jP Z (? 70w [P P ? (0?hLP P` `0YPvw6/ЍpTOBE(oqx)qp4q pI6q~qqqqqqɎq^qppqqqpqp2qFqqqyqq0p@-A(M0@0Si PP@d P@00  |P@0d4  \P@@K DP@@DD ,ߧP@0!ĬԧPD  ̧PH L0屬%P@0S (  h      !$ $0厬@劬(Ѝp.q^qqqq[quqqqq46qq͑qqN-MvP  P |PP!Pi WP * TP00a|C1[  0P @,:0 0p}0Ppp00 [P4JH L0vP "H0S!L\  01 . HL p0@00T *0 S  0SP` @L h  P!P @| >P|Mg8TPP| ,P| HD DW8UP@PP|0S (00<00,0000 0400000 00$00(00,00000400800<00@00D0\0GE?FoD`0儰d`h $0tP 7t  !1夦PDp ៦PC0 R #R  0 R #R  Z0 S00R  0S0000G0pW &  ppp `{ppp0S t&  00000 {0P v{0-S0 SR!QRR00R0S b 6P`%P0M?P0 )P |00C|0@ oT |xxvtAPPd8P@w:nx@P@n0:0 0yx`Pe?Y`dpT@ ĥ?p0PU $  PPP PPPP0T@*,0S;0G_00000 @0F/ 0S  0000-S0 SRQRR00R0S ᦥP 塥P MO@PU|,ụP TbT@P0T*ብPT0T@$MOP0T*MO{P0  000P5 `0` 0S+ <00x $0P7HP P 0S 4;P 0PN 00@ 0PH B@ `P; 10!00PPP80@8P0S 8谗q@-B7P6ڗqR@- 0   qq0/    /Dq8@-H@*A8P4 [@   8/qDq-0-$M 000000  0P P   $ЍЍ/$q8@-P `0* @P H@@"P8GPP 8/q[q/qTqq@-@0SaP4 0S 00000000*0M Pd0 S 0P00c 0 00P  Ѝ/qqqיq-@-<0 P @`L Ѝ@ Ѝ/(qq@- 0 u Ѝ@-@ 060 PL-M`P0 0 00 UT)* 0(p6P%MP" 05P0 d T 0.  0*T'%0p 0P @P Ѝ*qCqqN-(M`P0 0 0V0`d 0 $0 0 0 00 UT  030# 00SF  0Z`  0P 1P:P 6Z d0  " 0 V*C0 pWV`p@ 0XP 0  R0 00  0@ 0P 0@PZ,v$ 0q(Ѝ虚qqޚqN-8M`P0p00# 0( ,0 0 0r0@$00  0 0 0 (0 UT  030# 00SL  0G0 [P$04  0 ``C$0 ``FP@]P= 0EP$00S d0  "0 )@ 0P" 0 R 0 0400 0 0@ 0@P00S<0 0 $  08Ѝq q\qqN-8MP0p` 0( ,0 0 $0 04B 0p 0(0 UT030# 00S> PFPC 0P+4 ?[Z 0d0  " 0 J)70p 0P! 0 0Z@P 0@PDq 0 8m]Yd8Ѝ诛qq\qq0P 00 d@-@NP @@N-P0M0` pM0W0pP/.<JP7aP4 0IP#0 [Z  00 0P  )0  Z00  0@P 0 0@P 0Ѝq/q 0 /,q 0 /,q 0 /,qp@-`@PU@ T Pp\qN-P`PM$PH@0V*Xp@Y8 yZH tUP`N!P10!JE@I$ $@0DT$0 `0TX*Xp0x 0'PpX$xXpg'( (0 <ޞ8 8 0RH0 0(< 0(XX0d"< pR Pd#=0S JX0c#8 RD0S @X0d"E pR h8d&LQ T2,0@PЍ/qgqw9q+[qpqyqlvqqƜqϜqqqqqqN-(`pV@P;V0S V  0!kP  0 2 P[ 0 3/ 0 S Q00S3/PYT00S ?o2PPЍ+[qq+qwq/qlvq=q0@-`@`00T0  0PP Ѝ,qAq){qOq0F-QAM`0 P @ pdP X Q Q Q0U0r 0U $ hU PE@DaPU0P0D oT@@T  ǝ,I$GAߍfqwq/qmq+3q9qlvq0@-P@M 叞x1  ⥝P  P ,(00SЍ09qlvq/qqq@-p@PM aU 0\  bP  P`l⎝P` P∝P@<00S0Ѝ9qLqPqqlvq/qqqp@-`@PM |U h H!P D vP 0,00S Ѝp9qqlvq/qqqL-,0\MS@P XP a~P 0S P +P0 0P `V0505:@nm`p0 l 0$P 0 SR*U 0#,T02 0 \0QX S 0 0 0 0 2V  ⹡ PQ 00  V Q P `Vp0 `$p(   Q(0<0 00P 0(0, P - P (0S80000 0P 0|805 P d4 \Ѝ葝q͝q֝qߝqqq/q*q<qZq,qiqoqyqqqqq@-@XM00 S X  0d0  P P 0(AXЍ/qŞqqq@-`DMPp< 0@Tp `  P 00Q:,m0 0R*DЍ/qq/qDqp@-0`M`\0!|PX@dP` !ȜP 0  ⼜x`Ѝphq/q@-t00!lPX0 X0##<@T <%kP (UЍoq/qvqqF-@MRC @@`P20P00@ 0P 0P +84-f @ PPU  2R C ̛@q P@PU  1R @ 뽛@aP@PU  1R = 뮛@0x0t 0@PP-RP @ #a0P PPP Z  0R00 Y  0R{00pppW  0Rn00`U P hP-Hgߍ/qq՟qhqeqqeq8qeqqqqqBqqIq@-=oN-pHMQp_@P+P d ʚT``P0WM*0Y [, ἚY1 1` ᳚ ᫚ ᥚ 0  ❟ ᘚ0  ⒟ ፚ ቚ ᅚd ၚ-0S L zpX`HЍgqqqqsqq͓qyqqqqqqN-@XMPXL@ `pPg p0 PT` Q([0Q" h 001" 6 X t' p H i B0Q({qzq{q{q{q{qzqzq@X 0 ! Lpp 0 W |   [ \   @0Z< XЍ躟q@qqqq٠qߠqqqq0 R  / /q8@-@PT*(0UA008>8hqq0@-M @PP 0 0$000 1/Ѝ00@-M @PP 0 0$000 1/Ѝ00@-M @PP 0 00 1/Ѝ0@-P(@-P 03/ Ѝ7@-@PP  01/ Ѝ0@-P 03/ Ѝ7@-@PP Q  01/ Ѝ00@-M @PsP 0 0$000 1/Ѝ00@-M@P`P (0 0,00000 01/Ѝ00@-M @PKP $Q 0 0 01/Ѝ0B-`p@PU  0 T@1`pP`@-D Aa $D1/oЍXq0 /Xq0 /Xq0 /Xq@- 1/Xq/@-p0`X@@M@$ @ 㔙0` p@  000040 3/o@ЍЀXqN-P(M, (0 !@ '0  0 `Q@f##P K@   @,0K 1/up?o2,0K 0V  R 004 M0Z% 0K0,0K 0  0@P5/?o2,0 00 Z4,0 РKXq qN-(`0P`P,@P 0 0 QP`@ @ 0PL @0@᱗0@ @0㩗ЍEqsqqq@-NP (P0   ЍXq@-@P褢q8@-P@uPq P8$/q0/q0/$/qPP0@-PD@ A@Q4R S  ^000$/qq 0@000, ,0K@Ѝp$/qX(Uql+[qq٣qt7@-lP@Tc?0TT T02 l@D Wp (x@ BP Ѝ0$/q+[qq٣q(F-0@lpT00| @`@`PP0T *ẖPXP @ $00 0 Ѝ$/q*+[q:.q٣qs@-0@lPT00 P0 S`@00 0'X R"t Q@TT *X P !0dfVX  0`#T `>P00P0Ѝp$/qFI+[qDq٣q7@-0@lPTt00ll l0X@0P,!W0/1 P00CP0 Ѝ0$/qk+[qVq٣q@-L0@T l0P0Ѝ@| $0$0 0kЍ$/q+[qkq٣qN-4a@lpT8$@10!1T<PHQ @TC d! BP8@⚰ ⠖840CT84:L4p ci ɖp00j ㉖8$TP*84@0i84Ѝ$/q+[qq٣qB-p`P@T 緕P @0P0SP0 0 0Ѝ!q٣qB- p@lPT00&  @P`T YQR R Y\X T#`00@X Q404000( (0Ѝ$/q+[qq\qq٣q@-0PlpU00  `@08$S |,HQ͌00 0 V440000( (0} Ѝ$/q+[qq#xqq٣qF- adM@lPT10 p P 0Y  0 0 0S'84S00 Q!RP p Rp0%#0%h%* C㜕0HtLP84084dЍ$/qqq٣q+[q֤qB-` M@T00 0p P[P  R/>0DD D00U00 Ѝ$/q+[qq٣q@-`$M@T00 00p P(P 0S*?0<< <00 K$Ѝ$/q+[qq٣q@-xQMpp@`Pd10\I 0  00S8188!041@P< P@Pp 0 P ; PP p000 Pp 0 P P p "P WX0XqT0\0L a]Ѝ$/q q+[qq٣qqqq7@-@PU>0 0@l0 PZPU[P_oRtP %pP 0Y0a0l0X4Z[\]^_`d0h0 Ѝ0$/q+[q q٣qq0/q@-M08@ 0 嚘Ѝ/q2qp@-(M@00 00000 0`0P XPP00!R<004 40  0S(ЍpPqaeq٣q@-4@  4 0[Ѝ/qbqp@-M@00 00P0` xP?0!R?0L L0 0S0 84 0 <0Ѝpbqq٣q7@-APU10!1{tp ߓS.lۓP lP0l8P 0XPP<lP l P l P lS T=P lP l8CP l@=P l2P l' Ѝ0$/q+[q"q٣qnqUqqqqqq̥qڥqqp@-AMPMU10!1kS.hSS.ct8PZ tp j\t+PLQ[ Z0Stp ғSXS]S.⊓4Ud0 :Ph0Z0PS00[0XP?o2UY00o\P_o^R{P# Y0 S ^0S PPP\0…]0•YX0P`Sd S.!lA&l0 R ލЍp$/q+[q2q٣q P 0/q\q 0sqP 0\/qq 0gq P 00/qxq 0[qP 0\/qq@-@ 0 /qq @-(@oq7@-P@T00xx x0@\@T ]0SPPy04qP Ѝ0$/q+[qCq٣q q>q5qN-RM0`S @葟P { X@v Ph 9Pd  p0p0  PT 0 p 0&P <1@p0@@= iP@00 0xVl0% XPt00 0P t0t0X0SP `FooY0bS`V Za0P aPttЍ$/q qEqUq٣qN-R0`p(P,[  R  R$ =Bo/o" Y  ^ 0  Y P <  h0Z7#PPpPp)W@pWp $0$ (0 0ЍN>Ѝ\q'4qȧq8@-h@`1`@ TL@DD!081\ P(@T@P@  TP@Pm@  TP@\Pi@ ` TXPTXX 08qDq9q2q\q+[q`tqWqcqkqըqqoq͓qlvqqqq$qN-MPU00hh/h?|P|wP@8`P0$oSP?0w 0 00(00p00 40<00 00048 0P 408< p[40@0S5 W1ȣqqq(qpq CR00q0SH> 0@@X 0S#`0 CR00q0S? 0.C> 0#00 /=Z04  0R ,0 0@ ݔY,0 4  R= 0@ 4 QꐤqȦqDqqqqqxqqФqq@qqХqqqp8,0,08PF<0hW W 840P00PY:0W W *P0S:' P P0 SX0@T$ԅ>84St: C>,00 !  c,0 ỏ840C84$?0 8P X0`  㥏 8庎깿 8)89.P 8)00(00 S(0d ώP0J 08R` 0090()8  庎`PdZ 峎oob0S80L(<8<@@ <0Q 80(7Ph @ 0S` ``$ LPD@8$00(480 @0 }V PxwHp PqU`lj?^ e `[U|7|'QpSV p`M\ (pHWCY P: 4  .)$V P|=~Tp dPUX|P0S` l h pPP0WF* 0E (E  $0, 0  0 0 @ E0US 0US  0US  0US Q V P YpXPV PxTp P U` 84S E^P84Y* S V pHl 8pW,PV PCN} @ Pw Uxr~0PPPLP[ vEPA >P7JCpP@0080<0@08< 0P@/80P0S$ <@ 9800S2 U.Dq8q8qqq CR00y0S> 0;X b#`0 CR00y0S2 0+C> #0 00X4"P1;08 P PT,0( ,0( Jo8媢\ qqdqqlqHqTqqq q q q q<q0q$qZ= U U @0SP S :1@0SP S:11P e(/q+[qtqȧqUq/q2&qFq/qãq>qPq_nrvz~q~qqqlquqJqqqqqjqѪqqqq+qAqWqmqOqqw9qqqqq_5qk5qɫqMqݫqqqq.qAqqqqq;qqqKq^qxqq˭qqqxqqhq9qԠqq lvqr,N3dl ; Z|0 U U @0SP S:?0 <G@0S8$S:0!>0 :@800S0 pSЍF-P`p V R0P@VddC `06X `G⫌0 0`P00P0`XpãqqͰq00@-0 0 Ѝ+[qqq//@-7@-@ |PT괵qxqxqqqxqpqL k<00 00$  Ѝ0hqqqqq//B-HM`P` p0P0fp  0@P@ 0P<K8000 00P@HЍq"qqB-HM`P` p0P0fp  0l@P@ 0P<8000 00tdP@HЍ)qGqqP0p@-@P` ȋFP 0 0pp@Ppp@-PM @P`P F0P0 06`P`00 0яPЍpMq-@-P E ЍЍ/@-P@ 0P T *X (R `@80(帊P000Ѝڥqqq-@-P  ЍЍ/@-P@j^q@-@P T@wPqLq^q@-0 0 P 0ЍB-` pP0P0PMP P@! P ZfpP 0@P@D0U@ @ 5Z?0 0PЍ辱qqȱq qqp@-P`@-0UT00ps@-P@TOPdPJ 0P# P=  P `0@30$P P@PU 0 y0C?o23 T:@T@_@ЍpqQ6q?6q!2qI6q^nq(oqq+[q@-@Px[p弉P0% X嵉P0 @安P080C変P0 坉P0 喉P0,卉P0 0P倉P yP$ trP0 \kP0LL4 P<Ѝ+[qQ6q?6q4q!2qI6q^nq(oqLqPq+q;q1qHq/qq@-,(@(0T* @Wq4$qd$qbqRB-pш `t@t0T* .PP0G3/P< @0{$ 9P q4$qd$qoqqqN-0@SMP%&t@^ ً0 4 $0 Ћ8 ˋU<@  Ë@00000< RSK@ P⒉405X\P00 ` d0P0pWPP`G`0 [Z *4 0 0 ` X0 8 SR(,*L 1/P 40 P3/P X0 T`P0X0  0X \0 (0 Z0L  01/P?P0 0 0L0( 0@1/P x 0T^`P0 0 @D@ 00 R0 P  0c00  @0㛇T8`0  0P00 (0 Z0"l  0P0 0 0L0( 0@1/P l 0T`P0 0 QP 0 ` 0  @0`ٿ @0`T`&W U YT 0@P 3h0000L0Ѝ q#qLqXqjqqqq޳qqq7qOq[q(q`qlvqP@-d喿 L@ 08ǿpppqqP8@-u8 +@ X0㦿?ppmPjP:p8qӴq :@-jP ^8@-0PPဿ^P R@ayT@  5@o8qqlvq@-@PA@pT0`0\@P@-`p"PV@0P@U   QA&_`p  0 0- `R #$" 4"8#8 q0@- R 00#01 R # A"!P@T 0p 01@D #01 #01 #01 #\!0  00#01\ #0"q@-WʿB-P0@M$00`(0040@ <0\pP 0@0g@0`FX0@P@S@T @嬾Df=@ЍqqXq^qq7@-\   @ Č  @PU @PU\:$k Ѝ0qq\N-00CN0M0 0 0P0CaL,BP B ( T , ̠L 0 (X 4 $ A8< ,R@ ( A\`; a`   @ R52B0 24L lR`pǠŒ @ ,` p a q粐4L l pR*`\B`5"L022` gg `4@lV[ @d Tp$WL pTpd'*pd \-pW* ppd@ipT!*d W0@T*d@ppSf@ pTpd*pd \0Q00A00000QY `Q`0R ,fA0V@CI p`0`d0`0S0 0 SV0,ă0`p`V00& 0"@`w `q粐O@`A   S ^1:a a  n  0c<008< 0ЍqqqN-xM@8 QP\ xQA8PQ^#\^ @ 0Q P8`PU \*`P8pppPPUJ`VU _oR^PUPUX`xp`psWᲐP pUp`PEV PU xpPrUpᰢE``P P  4# @  @@ , # >    b/o"0 [Z 3 "RJ,@ TPD   x@PDU@DH$HTDE8 Q>@`@ @@P@@U@P@$@@P@P`@$@` @p`D@@w@4`2@`@gA(`$`P` ``4`@(``V(`P@AD @Q8 @,@P U P `@8p@`dတpW*pp`gV`0` @[Z`3`"VpaA@@@` @dDA@@`Q @A  R P , Q   @P2@Q @@@@@N  ! 0\xЍh'q$qP! 0S @- @@4 )@@@ S.@@ @ @(@,@0@8@<@l P L 00S 3//R6 <S1R  0P8@-@. 0 S(0 $0 S0P$0 0 (3/P U0Pe0E20/U0P0ES$0( 3/000$P408@/88qq0%0 P 8@-PU $0S 40@S 00S 3/$0(4 3/($0 3/8/8N-R X M`p H  3@TLD@DPU\EPEQ Rp]V0@P2TLD@D \0\\ \0 \  \0   \   \0 0 0  \0\ 0  0 \ 0 \ \\@\ 0 \ 0   0@  \P| @l PVm0`\1WV}GW=0pG0W G 00b0S1R0R@R0@0 RPP0 RP0 RP0 RP0 RP0RP0RP0R@RP0P0@RP0@RP0@RP0@RP@P 0`ppV0@P$? @; P ЍPB N-@0MT? 0S0S90 S 00 0008P 00<`0 0p00 00S!qqqq\qqq\q qqq,q8qqHqq4q qq q`q8qqhqqqPqHqq0S 02 VWi  pGV`/0U00S  10,0t0, -0)00`(0 0S 0 0 %4 Q  > R%4000  ,P%T, -P0`0PW 0pGV`V 0SP0  %4,P-0%8,%\ .0/P0`0PW 0pGV`V 0S   0%$ 0  ,P%T, -P`0P00; VW 0pGV` 0@PSP0<P ,P%T, -P{P R0`000 % @ W1![ 0S P 0 bQ  b 0    Q@0pk k@@0Sp0@0000;# Wg J Q0 \ @ R2@507S[:     $0$$0Spk  E R00@0000:# W9 J Q0 $\ @ (R2@507S[:     $0$0Spk   R$0000  VW   pGV`!Uh:`P R40,0  00  4W 0pGV`V%<,%4<0\TP4PP 0`0 0S 0 0 0p08P<`e0040 00 0S 0S 05S`0W 0pGV`V0P00S0 S S9 L0;P00 0X0T 08000%Q`F05S`VW 0pGV`8$%#8(""S8K`@00P0@0Sd R!1[![x  嫀 0pk0k 00 00@0k@Wf 0pGV` V0%< 20\0RSd0` 0%W`F07h000\ h0S*VW@ pGV`hT000Q`Fh0S  h '00 800 S>l0L00T0T00/>0l0p 0P060h000d`0h Rl*T0L0SW 0pGV`QV*W pGV`5S`c0 h0QV*W pGV`R5S`c, 0%Q`F"QV*W pGV`5SQ W pGV`V:5S Sc` R5000Q:h0 0h 0S S>l0L0 0/΄T0T0l 0p` $#0P0$4Fl0`P00X0X08 0d 0P0P450000S 3/,4 WR0 0p 8P<` 000p 08P<`T0L0 1RᲰWE 0pGV`S  03$0$00321\W* 0pGV`5R`bS5Q`a@0  0@20H000H0S V*W   pGV` @ 5S @ `c00X0P0 R1W 0pGV`$0$ 031 1[W 0pGV`5Q`a@5R`b10H00D0H0S V*W  pGV` D 5S D `c ,00 0bD RD1n00 0S 0  bD0S  c@0 00bS0a(4 c @S0! S0!c @c@AR 00@0S0A 0Sx  @00 00C 00000-q_qDqsqq'qqqqh0qq q'qCqqqqYqnq0S6 VWP 0pGV`0  b0R00000 0S0b 40S0%<,%4<0,4 S 0000 00`P 00000S 0S VW 0pGV`0U@1`P000000 0 0p0(08PS<`0SI0 RE P40S (0S $00!( ,0  $ 0(3/P400h`0( `fV :4b~000004 cVp1p!f }`V 4f }0`(0,0 00(, 0S000`R 0, 5`0P`f0Pe0000000000US 0 Se  d40< S@00 0 S000,00 0SQ 0S/0Ѝ@-g-004; 0Q@0  @A_opv^YpW S@?:?000cS00?0?000cS00?:0? Ѝ/N-P`p(0U*0@C@c@d  0     31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1 R:0",S413`//ar$//SRQPaM`-Ѝ /G- `p@P0##@T P0G/A-P@`pf$$`V0pA/QO-@PSSK UT 303;:  ` @p~ `8|U`T 303:@T>8<P P pf`@TP@P@PP WV@PP a4 A 5A5q~a00| R0@pP "0#O/r @pPQPG-@P33;::6 0` Cs~ c8|UcT 33:@T8PS pf`@TP@P@P0S WV@P0S42 b B15 50rpb3qXG/@-Q @/P !A" P !A"P !A" /0 000P)   $T D<  $ ltpHQld  \$ HQ\T  $  x $??!!$hlptx| `@STaETQEc[`bc$Swwwwcc2c@cF-@0,MP`p WPz00c Pu0L 00 p00$0 01/P k\ ZpbV` 0\t`DK 0`RtA ?,Ѝ:gqUgqtgqgq $*04<HPXh @@ U-Boot 2010.06em8-svn1123 (Nov 29 2017 - 08:25:32)3q3q3q3q3q3q3q3q3q3q3q4q 4q4q4q%4q-4q54q<4qC4qJ4qQ4qX4q_4qf4qm4qt4q|4q4q4q4q4qEPTGMK0123456789ABCDEF0123456789abcdef6nnandnand_fill_oobnand_select_chipnand_transfer_oobnand_scan_tailUVY ZZ YVUe03fq qNvSaveNvToMACNvToIPNvWorkcopyResetNvPrivImagesReadNvPrivImageRepairNvInitq¯q ίq $q 0ׯq4q8q@qqq qqq q$q-qyq3q<q qBqFqJqPnq Qq HqHq q(Vq,aq-oq4q5q8q<QqBqFqJqq  HqHqNvPrivFindParamqqq=qkqqӮqq>qyqqlvqNvCmdLineNvPrivCriticalSetFromArgVNvPrivCriticalPrintContentsFromArgVNvPrivCriticalPrintContentsNvPrivPrintCriticalNvPrivOSIntInRangelinux(@rootfshwce(wcefs( bootstrapubootNVRAMbootlogo  NvPrivOSCriticalPartResetNvPrivOSFlashReadNvPrivOSFlashWriteNvPrivOSFlashProtectboard_nand_initmxc_alloc_bufqqXqqHq!qXq(q q/q q6qHq>qqFqqNqTqSq TqHUq,Uq4VqETq4Vq!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     qq+[qqqqqqq+[q;Zx0NBoard: DIMM-MX53 1.0 [PORRSTWDOGunknownBoot Device: ONE NAND PATA SATA I2C SPI NOR SD MMC UNKNOWN Enable of backlight on display adapter failed NAND is write protected hw_base_board_codeBase: %s hw_revisionr%dDRAM: I2C: %s baudrate### ERROR ### Please RESET the board ### NAND: ipaddrloadaddrbootfileNet: Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32%pMeth%daddrethaddrethacteth%dmacskipethmacskipethprime, [PRIME] Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM ethrotatenonetretryyesonce## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to %pI4 %d.%d.%d.%dnonegatewayipnetmaskserveripnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) %lXfilesizefileaddr*** ERROR: Cannot mount *** WARNING: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail Retry count exceeded; starting again T /nfsroot/%02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *autoloadNFSRARP broadcast %d octet%lublksize%c%d%cFile too largeFile has bad magicblksize %lu MB received TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... tftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP from server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d %llu Bytes%s.%ld %ciB%s%08lx: %08x %04x %02x(null)Targeted peripheral clock should bewithin [%d - %d] mx53 pll1: %dMHz mx53 pll2: %dMHz mx53 pll3: %dMHz ipg clock : %dHz ipg per clock : %dHz uart clock : %dHz cspi clock : %dHz ahb clock : %dHz axi_a clock : %dHz axi_b clock : %dHz emi_slow clock: %dHz ddr clock : %dHz esdhc1 clock : %dHz esdhc2 clock : %dHz esdhc3 clock : %dHz esdhc4 clock : %dHz nfc clock : %dHz CPU Clock: %dHz Peripheral Clock: %dHz AHB Clock: %dHz IPG Clock: %dHz IPG_PER Clock: %dHz UART Clock: %dHz CSPI Clock: %dHz DDR Clock: %dHz NFC Clock: %dHz cpu clock: %dMHz Unsupported clock type! :( Can't find pll parameters: %d configuring peripheral clock DDR clock should be less than%d MHz, assuming max value Unsupported or invalid clock type! :( CPU: Freescale i.MX53 family %d.%dV at %d MHz clockinfodisplay mx51 clocks resetting ... Timeout!nand_resume() called for a chip which is not in suspended state BUG: failure at %s:%d/%s()! nand_base.cBUG!nand_write: Attempt to write not page aligned data nand_do_write_ops: Device is write protected nand_erase: attempt to erase a bad block at page 0x%08x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied, Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters create_bbt(): chipnr (%d) > available chips (%d) Bad block table not found for chip %d nand_bbt: Error reading bad block table nand_bbt: ECC error while reading bad block table nand_read_bbt: Reserved block at 0x%012llx No space left to write bad block table nand_bbt: Error reading block for writing the bad block table nand_bbt: ECC error while reading block for writing bad block table Bad block table written to 0x%012llx, version 0x%02X nand_bbt: Error while writing bad block table %d nand_update_bbt: Out of memory nand_scan_bbt: Out of memory nand_bbt: Can't scan flash and build the RAM-based BBT nand_bbt: Out of memory Bad block table at page %d, version 0x%02X ToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMDWinbondUnknownNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 1GiB 3,3V 8-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bit(not set)%-12s= 0x%08lX arch_numberenv_tboot_paramsDRAM bank-> start-> size%-12s= %s ip_addr = %pI4 baudrate = %d bps bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX rebootPerform RESET of the CPUstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as arguments console=bootcmd## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC Unknown image format! -noverify## Booting kernel from Legacy Image at %08lx ... Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Unsupported Architecture 0x%x Trying to execute a command out of order cmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartERROR: booting os '%s' (%d) is not supported iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)boot default, i.e., run 'bootcmd'bootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSloadoscmdlinebdtprepOFFInstruction Cache is %s Data Cache is %s dcacheenable or disable data cache[on, off] - enable or disable data (writethrough) cacheicache[on, off] - enable or disable instruction cacheList of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationunknown Date: %4d-%02d-%02d (%sday) %02d:%02d:%02d Reset RTC... ## Bad date format ## Set date failed ## Get date failed get/set/reset date & time[MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTCSunMonTuesWednesThursFriSaturecho args to console[args..] - echo args to console; \c suppresses newlineread EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... writeeepromEEPROM sub-systemread addr off cnt eeprom write addr off cnt - read/write `cnt' bytes at EEPROM offset `off'exitexit scriptalias for 'help'print command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'Valid chip addresses: %02XError reading the chip. %04x:Error writing the chip. CRC32 for %08lx ... %08lx ==> Error reading the chip, %02lx %04lx %08lx ? Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) i2cI2C sub-systemcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe - show devices on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedcrc32loopmmmwnmprobe ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Switch baudrate to %d bps and press ENTER ... ## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ESC ... loadsload S-Record file over serial line[ off ] [ baud ] - load S-Record file over serial line with offset 'off' and baudrate 'baud'Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX bytehalfwordword at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) Total of %ld %s%s were the same Zero length ??? CRC32 for %08lx ... %08lx ==> %08lx mtestsimple RAM read/write test[start [end [pattern [iterations]]]]infinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]1000???100halfIEEE 802.3IEEE 802.9 ISLAN-16T%u. (%04hx) -- %s -- (%04hx:%04hx) %u.%2u,%2u = b%u%u speed selection = %s Mbps%2u = %5u duplex = %s%2u-%2u = %5u selector = %s%2u-%2u = %u selector = %s%2u %2u-%2u = %5u %sFDXHDXPHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x duThe MII dump command only formats the standard MII registers, 0-5. miiMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.next page ableacknowledgeremote fault(reserved)asymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablexxx to doasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities registersleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!) (uses BBT)Device %d: %s, block size %u KiB, page size %u, oob size %u, chip size %llu MiB, DevID 0x%08x, Manufacturer ID 0x%08x%s No memory for page buffer Error (%d) reading page %08lx Page %08lx dump: OOB: bootdevice ** No boot device ** ** Device %d not available .jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error ** Unknown image type Automatic boot of image at addr 0x%08lx ... '%s' is not a number device %d whole chip offset 0x%lx, size 0x%zx scruberaseERROROKwrittenquietstats Device %i ecc stats: ECC uncorrectable errors: %i ECC bit errors corrected: %i No such device Device %d: %s... is now current device dumpmarkbadbiterrunlock no devices available Device %d bad blocks: %08lx clean NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobUnknown nand command suffix '%s'. %zu bytes %s: %s block 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systeminfo - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand erase [clean] [off size] - erase 'size' bytes from offset 'off' (entire device if not specified) nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub - really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off - make a bit error at offset (UNSAFE)ping failed; host %s is not alive host %s is alive hostnamerootpathdnsipdomainAutomatic boot of image at addr 0x%08lX ... pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocolrarpbootboot image via network using RARP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocolSaving Environment to %s... setenvenvironment name too long %s Environment size: %d/%ld bytes ## Error: "%s" not defined ## Error: illegal character '=' in variable name "%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Error: environment overflow, "%s" deleted runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'saveenvsave environment variables to persistent storagePOST status: failure warning pstatusprints the Power-On-Self-Test statusBad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory[addr] - run script starting at addr - A valid image header must be present-o-a-z-n!=<-eq-ne-lt-le-gt-getruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]print monitor version%s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands DIMM-MX53 # silent*** Warning - bad CRC, using default environment syntax error ERROR : memory not allocated ** Abort *?[\ERROR: There is a global environment variable with the same name. %s: readonly variableIFS \$'";&|#Unknown command '%s' - try 'help' or use 'run' command Unknown command '%s' - try 'help' ;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildonebootm_lowbootm_size%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sCreated: %4d-%02d-%02d %2d:%02d:%02d UTC %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx -## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... uncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedInvalid ImagefilesystemFilesystem ImageFirmwareKernel ImagemultiMulti-File ImageramdiskRAMDisk ImageScriptstandaloneStandalone Programflat_dtFlat Device TreekwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid OSLinuxwinceWinCEnetbsdNetBSDrtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32%.*sbootdelayHit any key to stop autoboot: %2d  0%2d ** Too many args (max. %d) ** ## Command too long! 'bootd' recursion detected miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' No such device: %s NULL device name! MII devices: '%s' Current device: '%s' PHY reset timed out PHY speedPHY AN speed read failed, assuming 10BASE-T PHY duplexPHY AN duplex read failed, assuming half duplex serialimage.%s%s-%sdimm-mx53usbrootmtdrootPartition %s not found Can't erase a critical partition Flash or partition is write protected. Can't erase it. command %s failed *** ERROR: Destination buffer overwrites critical system memory %p No valid U-Boot header tftp 0x%x %snfspath_bootnfs 0x%x %s/%susbpath_bootusb 0 0x%x %s%susb resetfatload %sTrying extfs2 ext2load %sNo bootable image %s mmc_part_kernelmmc_part_kernel_sizemmc read 0 0x%x %s %sNo image verification!Calculated data checksum = 0x%08lxImage is not created with mkimage (OK) CRC32 mismatch: Image reports 0x%08lx !!! Image platform magic does not match the running bootloader !!!! The image was created for "%s" but we are "%s" Continuing is extremly dangerous and might render the board unusable! Do you want to continue? Image Checkubootgo %xbootargs_linuxbootm %x %s%s will be booted now Need RESET board to recover setenv bootargsI suggest to use the 'firmware' command for updating firmware Flash or partition is write protected. Can't update it. loadaddr_updateDo you really want to overwrite U-Boot flash partitionUpdatingPartition too small Padding last sector Writing cleanmarkers Writing OOB failed UBI Erasecounters resetted Update successful Flash is write protected. Can't update it. NvOSCfgAdd(os_type, file_size)NvOSCfgSet(os_type, (void*) loadaddr, file_size)NvSave()Update failed erase_ptErases the partitionpartition - the name of the partition update_cfgextended update commandscfg source file - updates 'os configuration' via 'source' values for 'os configuration': display_table sd_firmware values for 'source': tftp, nfs, usb values for 'file' : the file to be used for updating partition [source [file]] - updates 'partition' via 'source' values for 'partition': uboot, linux, rootfs, wce or any other partition name values for 'source': tftp, nfs, usb values for 'file' : the file to be used for updating bootxextended boot commandspartition [source [file]] - boots 'partition' of 'source' values for `partition': uboot, linux, wce or any partition name values for `source': flash, tftp, nfs, usb, mmc tftpflashusbmmcimage.uImageubiu-boot-%sdimm-mx53-512.bin%s-%s.uzb-%i-nand%c%s=%s *%s=%s Resetting dynamic variable 0x71200000nand_wphw_board_identhw_product_type=${hw_product_type} hw_revision=${hw_revision} hw_patch_level=${hw_patch_level} hw_serial_nr=${hw_serial_nr} hw_base_board_code=${hw_base_board_code}usb_speedfullspeedboard_cfgCRC32: match: 0x%08x CRC32: expected U-Boot to have 0x%08x, is 0x%08x chkimgChecks that the U-Boot image in flash matches itselfNo registry partition available Partition is write protected. Do you really want to erase it?erasingerase_pt registrysetenv erase_hive_registry ysuccessfullfailedTesting bootloader checksum: Selftest %s Press any key to continue emtrion GmbH Bootloader for DIMM-MX53 with Revision 0 or higher %s Copyright (c) 2008 All rights reserved Bootloader menu 1.) Self test 2.) Clean WinCE Persistent Registry e.) Return to main menu q.) Quit and return to command prompt >Partition is write protected. Do you really want to continue it?command%s %s %sNo bootable OS partition found 1.) Execute stored Image 4.) Download Image via onboard Ethernet controller and store in Flash 5.) Download Image via onboard Ethernet controller, store in SDRAM and execute 6.) Extended functionality >provides the emtrion bootmenuconsole=ttymxc%i,%subi.mtd=%u ubi_mtdroot=/dev/sda1 rootdelay=10/boot/root=nfs rw nfsroot=${serverip}:${nfspath}${nfspath}/bootnfspath/nfsroot/dimm-mx53/rootfsmtdpartsip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:dimm-mx53:eth0:off${bootargs_linux_pre} ${ip} ${console} ${root} ${mtdparts} ${ubi_mtd} ${quiet} display=${display} display_phys_width=${display_phys_width} display_phys_height=${display_phys_height} display_configuration="${display_configuration}" display_calibration="${display_calibration_linux}" backlight_polarity=${backlight_polarity} nand_hwecc=0 nand_bbt=1 ${hw_board_ident} ${bootargs_linux_post}bootargs_wcebootargs_wce too long disable_nandDisabling NAND highspeedEnabling USB Highspeed display_phys_widthdisplay_phys_heightdisplay_calibrationdisplay_configurationerase_hive_registryClear hive based registry when starting WinCE now Could not find WinCE entry point! Erasing hive based registry Starting with existing hive registry Starting WinCE ... ${bootargs_wce_pre} display=${display} display_phys_width=${display_phys_width} display_phys_height=${display_phys_height} display_configuration=${display_configuration} display_calibration="${display_calibration_wce}" backlight_polarity=${backlight_polarity} nand_hwecc=0 ${hw_board_ident} erase_hive_registry=${erase_hive_registry} ${bootargs_wce_post}display_calibration_linuxdisplay_calibration_wcebacklight_polaritydisplay_table_revisiondisplay_table_version%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d0,0,0,0,0,0,0,0,0,0,0,0(skipped because of board configuration) Error at index %i %31s %nDisplay Table Version is incompatible. Need %u.%u, have %u.%u Display Table Version: %u.%u _entriesDisplay Table Revision: %d Supported displays: %u %u %u %s %x %u %u %s %s %u %u %u %u %u %u %u %u %u %u %u %u %u %u %u %u %u %i %u %sundefinedr%d%c%dxxx(couldn't read display table) LCD: ID = 0x%x (not configured) no configuration for %s available. Available are: %s,initialization failed bootlogo%ux%ux%sBootlogo format is %s, require %s, trying default GUNZIP: uncompress, out-of-mem or overwrite error Uncompressed bootlogos are not supported 565Color format conversion to %s not supported for bootlogo Downscaling of bootlogo not supported No bootlogo present Firmware '%s' not found No firmware partition present Not enough memory to modify firmware firmware magic not detected firmware crc length invalid firmware crc invalid, expected 0x%08x, have 0x%08x Cowardly refusing empty firmware not enough space removelist%s (len=%i, crc32=0x%08x) firmware maintaining commandslist - lists all firmware files firmware remove - removes a firmware from the firmware partition firmware reset - erases all contents of the firmware partition firmware update tftp|nfs|usb - updates a firmware to the firmware partition Version: %02x Data Length: %02x CRC16: %04x Type: %02x Revision: r%d%c (0x%02x) Variant: %02x %04hxError: invalid crc, it should be 0x%04x. NvCmdLine( argc - 1, (const char**) &argv[ 1 ] )Usage: %s Environment will be set to Default now! envresetSets environment variables to default setting - overwrites all current variables displays or modifies NVRAM contents like IP or partition table[help] This is an internal command. Use "nvram help" for detailed help %s: (%s) Flash is write protected. Continue? savingNvOSCfgSet( NVOS_UBOOT, env_ptr, CONFIG_ENV_SIZE )NvInit( mode )NvOSCfgGet( NVOS_UBOOT, env_ptr, CONFIG_ENV_SIZE, &size )*** Warning - bad CRC or NAND, using default environment NVRAM% 3i%% Erasing %i KiB @ 0x%08x: Erasing: complete *** ERROR: Erase failed Reading: Reading: complete *** ERROR: PartRead: Read failed at block @ 0x%08llx Writing: Writing: complete *** ERROR: Partition was too small *** ERROR: Write failed at block @ 0x%08llx Verifying: Verifying: complete *** ERROR: Verify failed No temporary buffer for CRC32 *** ERROR: Read failed at block @ 0x%08llx %c) %s Chip | Nr | Name%-*s |%s Start | Size | Type%-*s | FS%-*s | Flags%n %2i | %-*s | %-3i | %10s | %10s | %-*s | %-*s | fixed mounted readonly FS Version: %u%s (%s, ? for help)> %s (? for help)> %c OS Types: Partition table reset (%s):  *** Wrong value, try again %4sPartition is marked fixed, do you still want to modify it? Name Chip Maximum # is %u Start (0 for auto) *** Beyond end of flash, try again --> Set to %s Size (0 for auto, %s max) *** No space usable Fixed Readonly Filesystem Types Filesystem Root-FS Mount Readonly *** Partition table full *** Adding partition # %i Partition %u added *** No partitions available *** %s which partition? *** Partition %u not available *** ModifyDelete*** Partition is fixed, can't be deleted *** Partition %u deleted NvCriticalGet( &critical )Flash is write protected. Can't modify partition table. Commands: CmdPartition table has been modified. Save? Partition table NOT changed! mtdparts=;*** ERROR: need linux flash name @0x%llx( ro rwubi%u:rootfs rd0*** Unsupported filesystem 0x%xroot=mtdblock%i rootfstype=flpartdisplays or modifies the partition tableIs a GUI frontend to the partition part of internal_nvram physmap-flash.0sh_flctlAppend partitionDelete partitionModify partitionPrint partition tableReset partition tableQuit&Save*** ERROR: Mtd Chip %u out of range Warning: Unclean block @ 0x%08llx (correctable ECC errors) *** ERROR: Read for verify @ 0x%08llx failed *** ERROR: Difference @ 0x%08llx RAM: Flash: *** ERROR: MtdPageSize used for non-nand NVRAM: Original Flash is BAD NVRAM: Mirror Flash is BAD NVRAM: Original Critical is BAD NVRAM: Mirror Critical is BAD NVRAM: Original %u and Mirror %u don't match NVRAM: No NVRAM contents usable NVRAM: Using Mirror NVRAM: Using defaults **** ASSERT %s@%u:%s cmd_nvram/lib/src/nvram.c( eType == NVCL_ORIGINAL ) || ( eType == NVCL_MIRROR )NvFlashDetermineOffs: erase size too smallNVRAMCOut-Of-Range Partition TypeOut-Of-Range OS TypeCan't set OS Configuration to %i bytes, it already exists with %i bytes OS config beyond erase blockOut-Of-Range Loc TypemallocWriting Parameters #%u to NVRAM %02X:%02X:%02X:%02X:%02X:%02X%X:%X:%X:%X:%X:%X%u.%u.%u.%uNVRAM: Resetting Workcopy 192.168.2.20255.255.0.0192.168.43.30255.255.255.0192.168.0.254192.168.105.300:1C:1E:9F:FF:FE00:1C:1E:9F:FF:FFOut-Of-Range FS Type0x%08llx%LxNVRAM: Repairing %s OriginalMirrormalloc (flash input)NoneCriticalOS-MetaApplicationdisplay_tablesd_firmwarecramfsinitrdFlashFXyaffsromfsubifsBootstrapLinux-KernelWinCE-EBootWinCE-KernelWinCE-RegistrySplash-ScreenWorkcopyNVE_GOODNVE_NO_DEVNVE_IONVE_CRCNVE_MIRRORNVE_NO_SPACENVE_NOT_INITIALIZEDNVE_NOT_IMPLEMENTEDNVE_VERSIONNVE_MAGICNVE_MISMATCHNVE_INVALID_ARGNVE_WRONG_VALUENVE_NOT_FOUNDcmd_nvram/lib/src/nvram_cmdline.cArguments: help|print |printall|repair|reset|save|set params for "set" or "print" can be %-10s [%s%s] Params trailed with '=' require a value in the set command. In the print command, '=' mustn't be used. Possible Values are os type: partition type: flag_fs_type: Examples: %s print module ethaddr1 serialnr : prints mac address and serial number %s print partition select=0 name select=1 name: prints first and second partition name %s set network ip1=192.168.42.30 : changes the IP address intnvramno partition selectedno os selectedeMode != NVPM_ANYparameter '%s' is fixed%s=printall--reservedNVRAM Critical Parameter Status: Workcopy: Magic: %s Version: %02u.%02u (differs to library %02u.%02u) Update Version: %u Module ID P/N: %s S/N: %s Revision: %s Patchlevel: %u MAC %2i: %s %s%02x IP Device %i IP: %s NetMask: %s DHCP: %s Gateway: %s DNS %i: %s Server: %s NetConsole: %s Partition Table Nr | Name | Chip | Start | Size | Type | FS | Flags ---|----------------------|------|-----------|-----------|--------------|---------|------ %2i | %-20s | %-4i | 0x%08llx | 0x%08llx | %-12s | %-7s | mount-readonly Reserved: OS Configuration Table Type | Start | Size ------------|------------|----------- %-11s | 0x%08x | 0x%08x saverepairprint help : prints this print : prints selected parameters. E.g.: print module mac serialnr printall : prints complete contents and metainfo repair : Repairs the contents. If one image is bad, the good one is copied onto it. If both are good or bad, nothing happens. reset : resets everything to factory default values. save : saves the parameters set : sets parameters. moduleproducttypeserialnrpatchlevelethaddr1ethaddr2networkgatewaydns1dns2servernetconsoleip1netmask1dhcp1netmask2dhcp2adddelselectchipflag_fixedflag_readonlyflag_fs_mount_readonlyflag_fs_rootflag_fs_typeflag_fs_versioncmd_nvram/nvram_priv_uboot.ci < ARRAY_SIZE( critical->s.p.xPartTable.axEntries ) - 1Flash Read @ 0x%08llx, length = %iFlash Write @ 0x%08llx, length = %iFlash Erase @ 0x%08llx, length = %iNVRAM: The MAC address should be unique and not the factory default ProtectUnprotect%s failed @ 0x%08llx, length = %iVariable %s can't be deleted '%s' can't be changed with setenv hw_product_typehw_serial_nrhw_patch_levelCommands: %-24s - %s ** ERROR: Test failed: %s Test OK Test not found: %s This helptesthwInternal hardware test functions- This is an internal command. Use "testhw help" Usage: nand_pattern %s []Write is not verified itself Out of Memory for buffer Run: % 9id Erase failed at block 0x%08llx Read after erase failed at block 0x%08llx Not erased @ 0x%08llx Write failed at block 0x%08llx Read failed at block 0x%08llx Difference @ 0x%08llx Should Be: Is: Aborted by User nand_patternUsage: udelay Delaying for %i us. Signal on LED %i/GPIO %i Usage: sleep Sleeping for %i s. Signal on LED %i/GPIO %i udelay%s(y/n) %s aborted FEC: Link is down %x TX not ready TX timeout packet at %p FEC_RESET_DELAY timeout FEC: enable RMII gasket Could not establish link. FEC%dUnCorrectable RS-ECC Error Unrecognized NAND Flash device. %s: failed to allocate nand_info %s: failed to allocate data_buf %s: failed to allocate oob_buf SLCGiBMiBManufacturer : %s (0x%02x) Device Code : 0x%02x Cell Technology : %s Chip Size : %u %s Pages per Block : %u Page Geometry : %u+%u ECC Strength : %u bits ECC Size : %u B Data Setup Time : %u ns Data Hold Time : %u ns Address Setup Time: %u ns GPMI Sample Delay : %u ns tREA : %u ns tREA : Unknown tRLOH : %u ns tRLOH : Unknown tRHOH : %u ns tRHOH : Unknown Description : %s Description : == NAND Flash device info table failed validity check == Device Info Table: %s Table Index %u U-Boot BUG at %s:%d! nand_device_info.cType 2Large MLCType 7Type 8Type 9Type 10Type 11Type 15BCH ECC12H27UBG8T2M (4GB, 1CE), H27UCG8UDM (8GB, 2CE), H27UDG8VEM (16GB, 4CE)H27UEG8YEM (32GB, 4CE)MT29F32G08CBAAA (4GB, 1CE), MT29F64G08CFAAA (8GB, 2CE)MT29F128G08CJAAA (16GB, 2CE)MT29F16G08CBABA (2GB, 1CE)MT29F32G08CBABA (4GB, 1CE); MT29F64G08CEABA (8GB, 2CE); MT29F64G08CFABA (8GB, 2CE)MT29F128G08CJABA (16GB, 2CE); MT29F128G08CKABA (16GB, 2CE); MT29F256G08CUABA (32GB, 4CE)K9GBG08U0M (4GB, 1CE); K9LCG08U1M (8GB, 2CE); K9HDG08U5M (16GB, 4CE)TC58NVG5D2ELAM8 (4GB), TH58NVG6D2ELAM8 (8GB)TH58NVG7D2ELAM8K9NCG08U5MTC58NVG3D1DTG00TC58NVG4D1DTG00TH58NVG6D1DTG20JS29F16G08AAMC1, JS29F32G08CAMC1MT29F16G08MAA, MT29F32G08QAAMT29F64G08TAA (32Gb), MT29F32G08CBAAA (32Gb) MT29F64G08CFAAA (64Gb)MT29F128G08CJAAAJSF64G08FAMC1K9LBG08U0DK9GAG08U0D, K9LBG08U1D, K9HCG08U5DK9LBG08U0M (32Gb), K9HCG08U1M (64Gb), K9MDG08U5M (128Gb)H27UAG, H27UBGH27UCGMT29F2G08ABAMT29F8G08ABACAMT29F4G08ABAEAK9F4G08K9K8G08UXM, K9NBG08U5A, K9WAG08U1AK9WAG08UXMK9F2G08U0AK9F1F08TC58NVG1D4BFT00TH58NVG3D4xFT00TH58NVG4D4xFT00TC58NVG2D4BFT00K9G4G08U0MHY27UT084G2M, HY27UU088G5MNAND04GW3C2AN1EK9G8G08U0M, K9HAG08U1MHY27UV08AG5MIntel JS29F08G08AAMiB1 and Micron MT29F8G08MAA; Intel JS29F08G08CAMiB1 and Micron MT29F16G08QAAK9LAG08U0M K9HBG08U1M K9GAG08U0MIntel JS29F32G08FAMiB1 and Micron MT29F32G08TAAMT29F4G08JS29F08G08AAMiB2, JS29F08G08CAMiB2JS29F32G08FAMiB2HY27UW08CGFMS34ML08G2S34ML04G1NAND01GW3TC58NVG0S3NAND02GW3HY27UF082G2M, HY27UG082G2M, HY27UG082G1MMT29F2G08AADMT29F8G08ABABAK9F2G08U0MTC58NVG1S3HY27UH084G2M, HY27UG084G2M, HY27UH084G1MTH58NVG2S3HY27UH088G2MNAND08GW3BxANxMT29F8G08FABWGMT29F16G08ABACA(2GB)HLGWRODHLOARWROARHLODRWRODRWRBCWCLKWSTS_IIIWSTS_IIWSTS_IHLOAWROAHLODWRGRDWACKHMABMAMSKNLNFNFIELDEOFEOFIELDEOLNEW_CHANNEW_ADDRNEW_DATA1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionmachidUsing machid 0x%x from environment Starting kernel ... Warning: Erase size 0x%08lx smaller than one erase block 0x%08x Erasing 0x%08x instead Skipping bad block at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page aligned data Attempt to write outside the flash area NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read outside the flash area NAND read from offset %llx failed %d Skipping bad block 0x%08llx ### Warning: RTC oscillator has stopped raise: Signal # %d caught Cqq&q qxYqTqdqq4q q"qq"q̉q(((((AAAAAABBBBBBc@cc@S()*+,-./0123456789:;<=>?&0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N@q@qq@q q q q1tbBBbt0qqDqDqDqDqDq DqDq,DqDqDqDqDq3@Dqs@EqC@EqS@6Eq5 @LEqu @bEqE @yEqU @Eq6@@Eqv@@EqF@@EqV@@Eqx@Eq9@Fqy@Fqr@FqI@0Fqt@0FqY@HFqq@Eq@Eq@Eq@Eq@EqFqFq0Fq_FqHFqvFqFqFqFqFqFqGqGq.GqDGqZGq8qGqGqGqGqFq@ q Hq+[q+[qQq+[q+[qQq+[q+[q$Qq +[q+[q(Qq@+[q+[qq+[q+[qSqSqSqSqSqSqSqXqq+[q+[qXq q+[q+[qqD}q+[q+[qXqq+[q+[qXqq+[q+[qXqq+[q+[qYq|q+[q+[q Tqq+[q+[qxq|q+[q+[q}q0q+[q+[q@eqeqeqeqfq+fqq qqq4q q bqbq  cq cq !cq ,cq 7cqGcqbcqrcqcqcqbqwq  cq wq cq cq 7cqcqbcqcqcqcq ? dq ?dq/dq dq7cqHdq ddq dq dq dq dqdqcqeqeq cq%eq.eq:eqHeqxq^eq geq weq eq eq eq}qeq?cq0q0q8q8q@q@qHqHqPqPqXqXq`q`qhqhqpqpqxqxqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq q q(q(q0q0q8q8q@q@qHqHqPqPqXqXq`q`qhqhqpqpqxqxqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq q q(q(q0q0q8q8q@q@qHqHqPqPqXqXq`q`qhqhqpqpqxqxqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq q q(q(q0q0q8q8q@q@qHqHqPqPqXqXq`q`qhqhqpqpqxqxqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq q q(q(qbootdelay=4baudrate=115200loads_echo=1wqwq8wqwq wqwqwq wq hnq cq wq !{qoq,{q2{q8{q>{qE{qL{qR{qX{q_{q+[q+[qf{qs{qy{q{q{q{q{q{q{q {q{q{q{q{q{q{q{q{q{q{q{q{q{q{q{q tq|q |q|q |q#|q0|q9|qB|qH|q+[q+[q6zqDzqOzqq`zqqizqvzq|zqzqzqTqzqzqzqzqzq zqzq zq{q+[q+[q:6qyqyqyqyqyqzqzq#zq'zq+[q+[q  pqpqpqq neqleqweqbeqeeqfeqleqneqreqseq ueqweqFeq0eq jeqceqieqfeqyeqrequeq0eqq_{qq`zqȦqզqqqqDqqZq_qhq_{q,{qۦq8{qDqpq|qqZqgqqqqDqqqq}IOHisx{؂BRVzXXKi*xhkJ{t+9[z(1`7=H\($`e <gLne;yy7όe|D@w݅,8IgzqhfO&xGˊRWrq@ fE*4ϫQgTU~gKpJk+!J[5=b'qϩɛ OFN߃(%Q>6-F7S)T\M|aϘ{1b~ ƛobߘY\z8aKx:8ٚ]._--Ļv!Z~Xn_ $u!W˗-sv{O?X-lܲ3dnqoY.'P0}x _|5j[^^-A& *4d_.8~8;mVJ_S{jٹRm E}ݼ:oVEVurg7νH&56lKswxx6+z%smu+8~m8{-^]?rz-qv9^ WbኣC7-MGwo([ŀb-e"Xrl S_{!>oe-%}9v{UҜq>0uθ3R(. B#-EeqVǓ3>t? JrP>"VP2>[q<3zP:yc}+[;v?y+u{?|V_Z-mykG˘sQ}$>iv jн_[HjA4vmnd-oP:[vU#.-gnϞ^Ksl?Lswr~Yc}nl[yÞZ1vk*deJݽ6rM$Ƚo9s=Z N|]΅Hƾ]ζk I>yiMZ?{KSJ{ž%ezѧo \qke3z{61b%~[y독OzfҬd.kx_oZl:UQ!bX2'97V""ob>ڟrKx<IJ96΀(ivV_oSdF=Ui>O哃o"'P1˒BWWyT="BK=ݝg#WI۴bD3Wg:kFslA~vmŬMTdz7`z_Zr[nZn<{֗-; 9m^[5Oa}tw6>s,շ;,ֈ&wm j>3۴t~=n/FlilVߖZ}1_ijWeO皽r] KvV>C&vL[:}?m+}cn`?X_3Ks FkqVޕ7.ѬY|h=+כ| 9;MowjV\nZՎ\H` ,k6暿n._i~?wZUۜl*ӞW&=qgYEfb( v3o^Cܽz cO|uNsR`:wc۪hl_mY݃zU__U:7>=kZkósq\#F2jcgaSoA]BDYX]F{RU,fԚ]z3>\JTt\ s՜ 2I vsӷ}ᓌfrh|6ujg5%[>Qn?j)~Pv=zU@rf`YUgvĿmX*[64Z5/;c[52"6S:y s{=thYNU:9{ $WLWu+b,Qv+prr!nN [WGqNi?4Hк^WVvl"-4x\kG,m.pUCqWTN}}uay.fI3xiL "o%<1F' s:5':}ڦYf%o-Ua hOŷ#܅ze7:?ޱ󦣙|)ׯB@,O'SgWۘ{'ue? f,흍1o|9o]ižeM%WKw?wB~8Wvؿ6q1SU1~ݕf#P xD9]Z%Q.׿䴴,_=E5hJVAdBNʾ΍dhi74p2=q{%$AcX瓸.$~p]P{z%]r= -{Ig=<-@S4\UQiY00ĚST fHsi\ fטqb&Vf~eW}k:X+2Ee:?Z璌Q]TR+F5O,$ڪ3ꏾηFkh_*D;/,ta,>O]KA֯ 8\RHQ-rL)'3lFn!PoC]ʰuSq[lM }sw&$4ycœ MbY;T}K$YODHڗB܈F ];{>3ESqr+E*=fK=lv*N, H`!+h)dGT=:ʨm6YE2~.uilHPT[QO#33⑕cUu.jɨ?g#Y#D)Z P,R!GVn#Gjlrd')f iHBx`sj:K}l]@.(Zʕ1q=iY.RHVd*6ƖSfofqgލK6"qN1:-ڛG>_=zѶb:;ۤIL9O<]64zcEPbc-X4翚 5T\ߗ*'*=aQ{uH|v$]dqC#QUvfP@o1e_7 EjARGT{R~ڧ\%QD[ ŋQT1=_٫{Bs]`uFmZdU租?Y>:,ZߩS8x:_ׅj?DXc, q@ q       q q1tbBBbt0@ \q lq |q q, q, ʻq, q q -q 8q@@ @Qq@@@@ q @@ q @@Ⱦq@@-,@@ @@#q@@ҾqE@@-  @@ݾq@@ q,@@ q,8@(2q@@ ,q@@7qE@@-  @@-  @@- Bq, @@ iq @@ @@kqE @@- @@@vq @@@- q,@@@ q@@@-  @@- @@ ,@@- ,H q .q[qqq,@@ q,@@ q, @ Ƽq @@ ռq@@@#ݼq@@ q@@  q@@ q! Ϻq@qE@E @@@#.qE@@#@#>qE@# @Nq @^q @-2iq  @(q@@q@@<2q,@@q@q,@ 9q, @iq@@ sq@ q@ qx! qx! Aq  Xq  q,  q,  q,H  q,h  #q,  vq?q X q?q+[qOHqeqVHq+[qHqHqHqxqHqHq+[qq fqHqIqMq kqMqMqZ{qxgqNq+[qNq pqNq Oq\QqttqcQqQqQqtqQqQq%Rquq-Rq+[qNq@xqRqRqqYq yqSqSqPTqzqWTqiTqTq{qTq+[q_q {qTq+[qq {qTqUqjVq||qnVq}Vq8Zqq>ZqbZqz\qq\q\qXqq\q\q]q؊q ]q']qXq\q]q]q]qpq]q]q*oqq^q*^qXqqK^q_^qXqq^q^qXqdq^q^qqq^q^q>aq@qBaqWaqVfqؙq\fqzfqgkqqmkqkq!q hqkqkqnq`qnqnqnqqnqnq(oq q-oqnq]oqqfoqnqoqqoqnqoqqoqnq.qq q2qqZqqpq $qqqqq3rq TqqSqq*=~q,q*Sq*=qE~q*P>q$q*>qWqHq*lqq*;qzq*qq*hq*=qnqOq*2qLq*~qq*q*Cq^q*Cqq*Cq[q*Cqq*Cquq*Cqq*Cqq*Cqq*Cqdimm-mx53-3U,dimm-mx53-3힣=